PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35367
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 914aa    MW: 101743 Da    PI: 4.961
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35367genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.9e-29576626252
                     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Tp57577_TGAC_v2_mRNA35367 576 EKNVSLSVLQQYFSGSLKDAAKKIGVCPTTLKRICRQHGISRWPSRKINKV 626
                                79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166565646IPR003035RWP-RK domain
PfamPF020423.0E-26578626IPR003035RWP-RK domain
SuperFamilySSF542773.92E-21821908No hitNo description
Gene3DG3DSA:3.10.20.2401.3E-21822904No hitNo description
PROSITE profilePS5174520.526825907IPR000270PB1 domain
SMARTSM006663.4E-19825907IPR000270PB1 domain
PfamPF005641.4E-15827906IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 914 aa     Download sequence    Send to blast
MNMEDQFSSK DNGISFWTPL DNGMKSSITS DDMFNNISEL MNFDNYAGWC NGSSSLIDQT  60
LTSDLSSFAY SPHDGLSLVE QINGPFFMTD IGGNYSTTSY EEKVLLQQME TQFAFVDNAN  120
ETNNNNLDSQ FDMCNYVMSK SPSWSLDERM MSALSFFKES AGGGILAQFW VPIKYGDEIV  180
LTTSNQPYLL DQKLAGYREV SRSFTFSAEI KMGACCPGLP GRVFISHVPE WTSNVGYYHK  240
SEYLRLDHAI SHEVRGSIAL PISDMNSEVS CSAVLELVTT KEKPNFDKEL EYVSHALQRM  300
NLRTITPPRL LPQCVSNNKR AALAEIVDVL RAVCHAHRLP LALTWIPCYY SEGKGEESER  360
LRIKEGRTTN SDEKCVLCIE ESACYINDKM VEGFVHACSE HHLEEGQGIS GKALQSNHPF  420
FYTDVKAYDI SEYPLVHHAR KYNLNAAVAT RLRSTYTNDD DYVLEFFLPI DMIGSSEQQL  480
LLDNLSDTMR RICKSLRTVS EGELRGIEVS QDGFPKENIS GFFPMSKGNS QIAFSTGDPD  540
LFQMPLMAAN NGIQGSHSQV TSESRKQAEK RRNAVEKNVS LSVLQQYFSG SLKDAAKKIG  600
VCPTTLKRIC RQHGISRWPS RKINKVNRSL KKIQTVLDSV QGVEGVLKFD PHTGGFVAGG  660
SIIEQIGTCN KNLMFPEKSS VENSAIKLED DGVLISNSCE GDLKKDNNAS SDDYIQDSTS  720
WLWTKTHECP KQNSIDSVLE KEEDQCGLNN SSLHDIASNS SFSLIELGLD EGKGLDEPNH  780
PTSSSMTDSS NASGSMVRGS SSGSQSIENH KNSKIKSICV DSESKFAVKA TFRGDTIRFK  840
FDPCLGCFQL YEEVATRFKL RNGSFQLKYL DDEEEWVLLV NDSDLKECVE VLSDSGTYCV  900
KLLVRDIHGD GNS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003606812.10.0plant regulator RWP-RK family protein
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLG7JDS30.0G7JDS3_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA12G05390.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein